PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G01750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 347aa    MW: 37674.2 Da    PI: 7.1088
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G01750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-173380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  LPERR01G01750.1 33 RGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 80
                     89********************************************97 PP

2Myb_DNA-binding53.65e-1786129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  LPERR01G01750.1  86 RGNLTPEEQLLILELHSKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 129
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1992880IPR017930Myb domain
SuperFamilySSF466896.36E-3130127IPR009057Homeodomain-like
SMARTSM007171.2E-133282IPR001005SANT/Myb domain
PfamPF002495.9E-153380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-233487IPR009057Homeodomain-like
CDDcd001671.45E-113580No hitNo description
PROSITE profilePS5129426.28181135IPR017930Myb domain
SMARTSM007171.5E-1585133IPR001005SANT/Myb domain
PfamPF002496.7E-1686129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-2488134IPR009057Homeodomain-like
CDDcd001673.76E-1390129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MSQRRGAGGL GAANSAVIMS KQQQEAEEME LRRGPWTLEE DNLLMNYIAC HGEGRWNLLA  60
RCSGLKRTGK SCRLRWLNYL KPDIKRGNLT PEEQLLILEL HSKWGNRWSR IAQHLPGRTD  120
NEIKNYWRTR VQKQARQLKV DANSTVFRDA VRCYWMPRLL EKMAAADQIP PPLHHAAGAM  180
AGVSSSPFDG GSHLINHNNV SSSSYGHQIE PSPTTSSASG CSTAAAAMIQ PVPCFSDQMR  240
WDHHQIMQSS SGELDGGAGV FDSATMGSLG LDGLDLGPAD YEYYPHSTLL DYLNSTCTGS  300
AMMMSSSGGH GNGGYNYCAG GGMDGGDELY CQAAAAARKV GEWGGGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26301344107B-MYB
1gv2_A1e-26301341104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1074241e-160AK107424.1 Oryza sativa Japonica Group cDNA clone:002-127-F10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633684.11e-157PREDICTED: transcription factor MYB108 isoform X1
TrEMBLA0A0D9UWC40.0A0A0D9UWC4_9ORYZ; Uncharacterized protein
STRINGORGLA01G0016500.11e-157(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.13e-80myb domain protein 62